PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G2341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 331aa    MW: 37035.8 Da    PI: 5.8798
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G2341genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G g+W++++   g+ R+ k+c++rw +yl
      Gh_D11G2341 14 KGPWTPEEDIILVSYIQQHGAGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding45.71.5e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_D11G2341  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.649965IPR017930Myb domain
SuperFamilySSF466891.5E-3011108IPR009057Homeodomain-like
SMARTSM007175.4E-141363IPR001005SANT/Myb domain
PfamPF002497.1E-161461IPR001005SANT/Myb domain
CDDcd001671.18E-101661No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129418.7566116IPR017930Myb domain
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PfamPF002495.7E-1367112IPR001005SANT/Myb domain
CDDcd001678.66E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ QHGAGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLNKFQ  120
SALDPHPSIE RKSSLEFAST SSSTSAVGLN QASSTYASST ENISRLLQGW MRSSPKTTND  180
NNSSLLLKDT SQYQKWDQNT SLDADSSAGY KPKAEQEGGN LISHEEFESI LSFANINNVV  240
WDKSTCESTS KGACQDSGND DDGDDDDDGD DKVNVAMAPE NYKKQKVDHH NNNNNNKNNQ  300
PLSFLEKWLF DESSSGQAEE MNQMMELSSV F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-221211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492430.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-83MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2QYY30.0A0A0D2QYY3_G
STRINGPOPTR_0013s06390.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-98myb domain protein 60